PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g60750.2.p
Common NameLOC100832122
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 400aa    MW: 43456.4 Da    PI: 5.9811
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g60750.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3366.7e-1036739476374
              GRAS  76 eelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdi..sqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLa 166
                        ++aa++ f +++P+l+++  +aNqaIlea+ege+ vH++D++      +QW+ Ll+ La+Rpegpp++R+T+v++    +k+ l++t+  L+
  Bradi2g60750.2.p  67 ASAAARRHFLDLCPFLRLAGAAANQAILEAMEGEKIVHVVDLGGcgADATQWLELLRLLAARPEGPPHFRLTAVHE----HKDLLSQTAMVLT 155
                       56789999**********************************96335789**************************....9************ PP

              GRAS 167 kfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrll.................................desvsles...e 223
                       k Ae+l+vpf+fn++++ rle+l++e+Lrvk+gEala++++lqlh ll                                       +    +
  Bradi2g60750.2.p 156 KEAERLDVPFQFNPVITPRLESLDVESLRVKTGEALAISCSLQLHCLLatdedaspdsssaaaekgsaaaerrsspessglL-----SPpttR 243
                       **************9999******************************************************9998655431.....223335 PP

              GRAS 224 rdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWr 316
                        +++L ++++lsPkv+vvveqea+hn++ + erf+eal+yy+alfd+le++++r+s er+ vEr llg+ei+++vac ga+rrerhe++e+W 
  Bradi2g60750.2.p 244 LESFLGALWGLSPKVMVVVEQEASHNTAGLTERFVEALNYYAALFDCLEVGASRASVERARVERWLLGEEIKDIVACDGAARRERHERAERWA 336
                       678****************************************************************************************** PP

              GRAS 317 erleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                       +r+e+aGF  vpls++a  qa++  +  + +g++v ee+g+++l+W+dr+L+svSaWr
  Bradi2g60750.2.p 337 ARMEAAGFAGVPLSYYALLQARRAAQGLGCEGFKVREEKGTFFLCWQDRALFSVSAWR 394
                       *********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.4041374IPR005202Transcription factor GRAS
PfamPF035142.3E-10067394IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MIQQQDTEGS SSSVTSSPLQ NFSAMPLHPG TAAAHTPAAA APPWMLRELR SDERGLCLIH  60
LLLNCAASAA ARRHFLDLCP FLRLAGAAAN QAILEAMEGE KIVHVVDLGG CGADATQWLE  120
LLRLLAARPE GPPHFRLTAV HEHKDLLSQT AMVLTKEAER LDVPFQFNPV ITPRLESLDV  180
ESLRVKTGEA LAISCSLQLH CLLATDEDAS PDSSSAAAEK GSAAAERRSS PESSGLLSPP  240
TTRLESFLGA LWGLSPKVMV VVEQEASHNT AGLTERFVEA LNYYAALFDC LEVGASRASV  300
ERARVERWLL GEEIKDIVAC DGAARRERHE RAERWAARME AAGFAGVPLS YYALLQARRA  360
AQGLGCEGFK VREEKGTFFL CWQDRALFSV SAWRGRRFD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-417739485375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3648261e-139AK364826.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2028K08.
GenBankAK3656881e-139AK365688.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2036F09.
GenBankAK3722021e-139AK372202.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2148A03.
GenBankAK3739581e-139AK373958.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3049D13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014755283.10.0PREDICTED: scarecrow-like protein 3
RefseqXP_014755282.10.0PREDICTED: scarecrow-like protein 3
RefseqXP_003565067.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR81e-120SCL3_ARATH; Scarecrow-like protein 3
TrEMBLI1HV730.0I1HV73_BRADI; Uncharacterized protein
STRINGBRADI2G60750.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.11e-40scarecrow-like 3